PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G224400.2
Common NameB456_008G224400, LOC105764982
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 382aa    MW: 42557.5 Da    PI: 9.3605
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G224400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32200253255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gorai.008G224400.2 200 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 253
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15197253IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28198253IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23200253IPR006447Myb domain, plants
PfamPF002492.5E-7201252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MELFPDLSLQ ISPPNPKPTS TCRTREEDID LGFWKRPLDS RNSISSMAKP DNCIDLSLSN  60
PRISESNSNH LQLLHNGTAN CNGNLFHAYN QNHFPYHHKH LQHPLLYQHQ QQRQQQQQGL  120
GQELGFLRPI RGIPVYQNPP PPPFPFAQQP LDSSLASSPS SLASNTINTS STSLSPFQSQ  180
GLMRSRFMSR FPAKRSMRAP RMRWTTTLHA RFVHAVELLG GHERATPKSV LELMDVKDLT  240
LAHVKSHLQM YRTVKTTDRA AASSGQSDAF ENGSSGDTSE DLMMDIQNPR RSEMSVQQGR  300
SSSSSNAYQD KEYHGLWSNS SREAWLHGKP KDSAGNVPSL QKDMDPKCLS HERVSDGSSS  360
SLSGTSPKKP NLEFTLGVLP H*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2431300.0AC243130.1 Gossypium raimondii clone GR__Ba0240C19-hnz, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012439289.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6168e-89KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2TAU60.0A0A0D2TAU6_G
STRINGVIT_02s0012g01940.t011e-177(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-73G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]